PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_016825-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family bHLH
Protein Properties Length: 300aa    MW: 32449.6 Da    PI: 5.2495
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_016825-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH29.61.3e-09176227455
                    HHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
            HLH   4 ahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                    +h+ +Er RR++i +++  L++l+P + k +     Ka +L + ++YI+sLq
  NNU_016825-RA 176 SHSLAERARREKISERMKILQDLVPGCNKVQYVVIGKALVLDEIINYIQSLQ 227
                    8*************************866666669****************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474591.11E-16170245IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000837.60E-10170231No hitNo description
Gene3DG3DSA:4.10.280.103.8E-16172245IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088815.466172226IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000103.8E-7176227IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003531.0E-8178232IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MDPPSLINEG SFPSANPSSY SLAEIWPFPL NGGGGVGDSA GVLGLRRNHF GQNLSGFVET  60
NGNGTVAVNR DLSIDESTVT EQSGSRGGSG RKRRDAGSED ESSKLVSTSS GNDVNDCDGK  120
RLKVSGSKDE NGDSKAEVEA SSDAGNKAAE QNTQPPERLK QDYIHVRARR GQATDSHSLA  180
ERARREKISE RMKILQDLVP GCNKVQYVVI GKALVLDEII NYIQSLQRQV EFLSMKLEAV  240
NSRMNPTIEG FPSKDYGAQA FDTTGMAFSS QATREYGQGS QPEWLHMQVG GGFKDQHDFS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010272169.10.0PREDICTED: transcription factor bHLH79-like isoform X2
SwissprotQ9LV174e-80BH079_ARATH; Transcription factor bHLH79
TrEMBLF6GTC51e-136F6GTC5_VITVI; Putative uncharacterized protein
STRINGVIT_17s0000g05370.t011e-135(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59640.15e-84BIG PETAL P